PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG039700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 281aa    MW: 29984.8 Da    PI: 9.7363
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG039700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.9e-19114168256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++k+q  +Le++F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Pavir.4NG039700.2.p 114 RKKLRLSKDQAAVLEDCFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTK 168
                          678899***********************************************98 PP

2HD-ZIP_I/II125.32.8e-40114204192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlsk+q+++LE++F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rLeke ++Lr +
  Pavir.4NG039700.2.p 114 RKKLRLSKDQAAVLEDCFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCERLADENKRLEKELADLR-A 202
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 lk 92 
                          lk
  Pavir.4NG039700.2.p 203 LK 204
                          55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.471110170IPR001356Homeobox domain
SMARTSM003892.7E-16112174IPR001356Homeobox domain
SuperFamilySSF466895.56E-18113179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-17114168IPR009057Homeodomain-like
CDDcd000863.32E-15114171No hitNo description
PfamPF000461.5E-16114168IPR001356Homeobox domain
PRINTSPR000313.8E-5141150IPR000047Helix-turn-helix motif
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PRINTSPR000313.8E-5150166IPR000047Helix-turn-helix motif
SMARTSM003401.4E-21170213IPR003106Leucine zipper, homeobox-associated
PfamPF021831.3E-9170204IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MMMPQSGGSL DLGLSLGLSS QGSLSSSTTS GALSPWAAAL SSVVGGVMTR RDAHAQQHGA  60
AAAMMDPDRA AMRASTSPDS GASGDNKRER ELERTGSGGV RSDEEDGADG AAGRKKLRLS  120
KDQAAVLEDC FKTHSTLNPK QKVALANRLG LRPRQVEVWF QNRRARTKLK QTEVDCEYLK  180
RWCERLADEN KRLEKELADL RALKAAPSPA AQHASPAATL TMCPSCRRVA AANHPQQCHP  240
KSNAAGNVVP SHCQFFPAAV ERTGQSTWNA AAPLVTRELF *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.147240.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0932881e-147FP093288.1 Phyllostachys edulis cDNA clone: bphylf053m07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964497.11e-129PREDICTED: homeobox-leucine zipper protein HOX2-like
SwissprotQ5VPE37e-95HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2
SwissprotQ84U867e-95HOX2_ORYSI; Homeobox-leucine zipper protein HOX2
TrEMBLK3XYL11e-129K3XYL1_SETIT; Uncharacterized protein
STRINGSi007019m1e-128(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-57homeobox from Arabidopsis thaliana